chessgames.com
Members · Prefs · Laboratory · Collections · Openings · Endgames · Sacrifices · History · Search Kibitzing · Kibitzer's Café · Chessforums · Tournament Index · Players · Kibitzing
Harry Pillsbury vs Emanuel Lasker
"Pillsbury d'oh!" (game of the day Aug-01-2005)
St. Petersburg Quadrangular (1895/96), St. Petersburg RUE, rd 10, Jan-04
Queen's Gambit Declined: Pseudo-Tarrasch. Primitive Pillsbury Variation (D50)  ·  0-1

ANALYSIS [x]

FEN COPIED

Click Here to play Guess-the-Move
Given 94 times; par: 40 [what's this?]

explore this opening
find similar games 13 more Pillsbury/Lasker games
sac: 18...Ra3 PGN: download | view | print Help: general | java-troubleshooting

TIP: You can step through the moves by clicking the < and > buttons, but it's much easier to simply use the left and right arrow keys on your keyboard.

PGN Viewer:  What is this?
For help with this chess viewer, please see the Olga Chess Viewer Quickstart Guide.
PREMIUM MEMBERS CAN REQUEST COMPUTER ANALYSIS [more info]

A COMPUTER ANNOTATED SCORE OF THIS GAME IS AVAILABLE.  [CLICK HERE]

Kibitzer's Corner
< Earlier Kibitzing  · PAGE 3 OF 5 ·  Later Kibitzing>
May-05-05  notyetagm: What a tremendous game by Dr. Lasker.
May-05-05  Calli: <notyetagm> Really? You think it might become famous?
May-06-05  notyetagm: <Calli: <notyetagm> Really? You think it might become famous? >

Just stating my admiration for Dr. Lasker's brilliant play, that's all.

Aug-01-05  PaulLovric: lol, they are still annoyed
Aug-01-05  RookFile: They had a term for Emanuel Lasker,
I forget exactly what it is right now.
It was something like "fantastic energy", and conveyed the notion of a genius, supremely motivated, giving the game everything he had. That was what a formidable opponent he was in his best years.
Aug-01-05
Premium Chessgames Member
  offramp: I believe his close friends used to call him "Die Unwahrscheinlichspannkraftmeister".
Aug-01-05  sneaky pete: <offramp> "Der" please, unless his name was Emanuela.
Aug-01-05
Premium Chessgames Member
  offramp: I was taking the noun as being Spannkraft.
Aug-01-05  molle2006: The gender of a german noun is always taken from the last part of the word. This just by the way...

This game is really impressive, because (with Kasparov's notes in the Fritz Database) it is really a game between two human beings and not just a sequence of moves. Both of them get nervous, make mistakes and so on, and you can really imagine these two brilliant men sitting at the chess board and trying to beat each other with the power of their minds.

Aug-01-05
Premium Chessgames Member
  chancho: This is the game where Pillsbury noted that 7 Bxf6 was a better move. He waited eight years to spring that novelty on Lasker.
Aug-01-05  kevin86: Lasker takes Pillsbury to the woodshed;mate will follow in two after ♗d8+
Aug-01-05  britny rules: this is one of the best games i have ever seen!!!
Aug-01-05  Hincho: 27...Q - f5+ 28.K-h8 is there a defence? Gentlemen start your computers.
Aug-07-05  dac1990: <Hincho> No, there is not.
Aug-20-05  patzer2: The most amazing thing about this game is the analysis done by Kasparov and friends for his forthcoming book.

Initially, it appeared 28. Qf5! Kg8 29. Kb1 equalized and gave White a forced draw.

However, at the Chessbase.com site provided above by <Sergey Sorokhtin>, Kasparov's subsequent analysis demonstrated a win for Black after 28. Qf5+! Kg8 29. Kb1 (29. Qe6+ Kh8 30. Kb1 Bxd4 ) 29... Bxd4! 30. Re1 Qb4+ 31. Kc1 Qc3+ 32. Qc2 Qa1+ 33. Qb1 Rc3+ 34. Rc2 Be3+ 35. Rxe3 Qxb1+ 36. Kxb1 Rxe3 (Sorokhtin).

<Sergey Sorokhtin> am I correct in assuming you found the win for Black after 28. Qf5+ and provided the correction to Kasparov?

Aug-20-05  Calli: Yeah its amazing how many times Kasparov can get it wrong and then be corrected by an amateur with a computer.
Feb-12-06  MorphyMatt: The Mammoth Book of the World's Greatest Chess Games says that Pillsbury resigned after 28... Qc3+
Jun-17-06  GeauxCool: Lasker's superior development begins creating threats by move 17...Rxc3!! -Fine
Jun-17-06  TheBB: This game is analyzed at the bottom of this Chessbase article:

http://www.chessbase.com/newsdetail...

Jun-18-07  docofthree: pillsbury had win with 28 Qf5+ i have tremendous respect for lasker but i believe pillsbury was a better player and could have won the title in1895 or 1896 before his illness progressed
Jun-18-07
Premium Chessgames Member
  SwitchingQuylthulg: <docofthree: pillsbury had win with 28 Qf5+> Is this some sort of joke? If so, you have a weird sense of humour.
Jun-18-07  docofthree: no joke,you can win without a queen i believe queen sac gets at least a draw after 29 Qc3
Jun-18-07  docofthree: i meant 29 Qd3
Jun-18-07  ounos: <docofthree>, 29. Qd3 Rxd3. Maybe you played two moves for White by mistake.
Jun-26-07  notyetagm: 18 ... ♖c3-a3!! followed eight moves later by 26 ... ♖c3xa3!!, offering to sacrifice the second rook on the exact same square on which the first rook was sacrificed, is brilliant beyond words.

Position after 18 ... ♖c3-a3!!


click for larger view

Position after 26 ... ♖c3xa3!!


click for larger view

Jump to page #    (enter # from 1 to 5)
search thread:   
< Earlier Kibitzing  · PAGE 3 OF 5 ·  Later Kibitzing>

NOTE: Create an account today to post replies and access other powerful features which are available only to registered users. Becoming a member is free, anonymous, and takes less than 1 minute! If you already have a username, then simply login login under your username now to join the discussion.

Please observe our posting guidelines:

  1. No obscene, racist, sexist, or profane language.
  2. No spamming, advertising, duplicate, or gibberish posts.
  3. No vitriolic or systematic personal attacks against other members.
  4. Nothing in violation of United States law.
  5. No cyberstalking or malicious posting of negative or private information (doxing/doxxing) of members.
  6. No trolling.
  7. The use of "sock puppet" accounts to circumvent disciplinary action taken by moderators, create a false impression of consensus or support, or stage conversations, is prohibited.
  8. Do not degrade Chessgames or any of it's staff/volunteers.

Please try to maintain a semblance of civility at all times.

Blow the Whistle

See something that violates our rules? Blow the whistle and inform a moderator.


NOTE: Please keep all discussion on-topic. This forum is for this specific game only. To discuss chess or this site in general, visit the Kibitzer's Café.

Messages posted by Chessgames members do not necessarily represent the views of Chessgames.com, its employees, or sponsors.
All moderator actions taken are ultimately at the sole discretion of the administration.

This game is type: CLASSICAL. Please report incorrect or missing information by submitting a correction slip to help us improve the quality of our content.

<This page contains Editor Notes. Click here to read them.>

Home | About | Login | Logout | F.A.Q. | Profile | Preferences | Premium Membership | Kibitzer's Café | Biographer's Bistro | New Kibitzing | Chessforums | Tournament Index | Player Directory | Notable Games | World Chess Championships | Opening Explorer | Guess the Move | Game Collections | ChessBookie Game | Chessgames Challenge | Store | Privacy Notice | Contact Us

Copyright 2001-2025, Chessgames Services LLC